PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_55123g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 245aa    MW: 27480.9 Da    PI: 7.826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_55123g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEde l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
    MA_55123g0010 14 KGAWSKEEDEVLIAYIQAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.71.3e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEd+l+++++ +lG++ W++Ia++++ gRt++++k++w+++
    MA_55123g0010  67 RGNFSPEEDDLIIKLHSMLGNK-WSLIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.41961IPR017930Myb domain
SuperFamilySSF466892.02E-3013108IPR009057Homeodomain-like
SMARTSM007172.5E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001675.88E-101661No hitNo description
PROSITE profilePS5129428.76562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2865116IPR009057Homeodomain-like
SMARTSM007173.6E-1866114IPR001005SANT/Myb domain
PfamPF002492.1E-1767111IPR001005SANT/Myb domain
CDDcd001676.24E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWSKE EDEVLIAYIQ AHGEGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF SPEEDDLIIK LHSMLGNKWS LIASRLPGRT DNEIKNYWNT HIKRKLLERG  120
VDPYTHLSTT PDHGSFGFSS ENRVLSKRRC KPSEVFTDFF QQQTPETSKI ISRSHDHADD  180
EDVNLDLSIT LPSLCSSQGA SSSSKEPSSG IGLSNDCIQQ DHKREICCHI GLRTVGGSCC  240
SGCWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1124450.0BT112445.1 Picea glauca clone GQ03315_F24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826645.12e-87PREDICTED: myb-related protein 308
SwissprotP813933e-84MYB08_ANTMA; Myb-related protein 308
TrEMBLW1NDS73e-87W1NDS7_AMBTC; Uncharacterized protein
STRINGGRMZM2G050305_P016e-83(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-82myb domain protein 4